Lineage for d2bp3b_ (2bp3 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300237Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1300238Protein automated matches [190226] (22 species)
    not a true protein
  7. 1300290Species Human (Homo sapiens) [TaxId:9606] [186988] (3 PDB entries)
  8. 1300292Domain d2bp3b_: 2bp3 B: [128920]
    Other proteins in same PDB: d2bp3a1
    automated match to d1v05a_
    complexed with gol

Details for d2bp3b_

PDB Entry: 2bp3 (more details), 2.32 Å

PDB Description: crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex
PDB Compounds: (B:) Filamin A

SCOPe Domain Sequences for d2bp3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp3b_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvsy
lpvlpgdysilvkyneqhvpgspftarvtgd

SCOPe Domain Coordinates for d2bp3b_:

Click to download the PDB-style file with coordinates for d2bp3b_.
(The format of our PDB-style files is described here.)

Timeline for d2bp3b_: