Lineage for d2bp3b1 (2bp3 B:1865-1954)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659093Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
    Pfam PF00630
  6. 659107Protein Filamin a [141023] (1 species)
  7. 659108Species Human (Homo sapiens) [TaxId:9606] [141024] (3 PDB entries)
  8. 659112Domain d2bp3b1: 2bp3 B:1865-1954 [128920]
    automatically matched to 2BP3 A:1863-1954
    complexed with gol

Details for d2bp3b1

PDB Entry: 2bp3 (more details), 2.32 Å

PDB Description: crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex
PDB Compounds: (B:) Filamin A

SCOP Domain Sequences for d2bp3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp3b1 b.1.18.10 (B:1865-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
cghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvsy
lpvlpgdysilvkyneqhvpgspftarvtg

SCOP Domain Coordinates for d2bp3b1:

Click to download the PDB-style file with coordinates for d2bp3b1.
(The format of our PDB-style files is described here.)

Timeline for d2bp3b1: