SCOPe 2.08: Domain d2bn7a1: 2bn7 A:1-176

Lineage for d2bn7a1 (2bn7 A:1-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (20 PDB entries)

8. Domain d2bn7a1: 2bn7 A:1-176 [128820]
   Other proteins in same PDB: d2bn7a2
   automated match to d1n51a1
   complexed with flc, leu, mg, mn, pro, zn

Details for d2bn7a1

PDB Entry: 2bn7, 2.4 Å

PDB Description: mn substituted e. coli aminopeptidase p in complex with product and zn

PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2bn7a1:

Sequence; same for both SEQRES and ATOM records:

>d2bn7a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d2bn7a1:

• d2bn7a1 first appeared in SCOP 1.73
  
• d2bn7a1 appears in SCOPe 2.07