Lineage for d2bn7a2 (2bn7 A:177-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974565Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2974566Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2974597Domain d2bn7a2: 2bn7 A:177-440 [128821]
    Other proteins in same PDB: d2bn7a1
    automated match to d1n51a2
    complexed with flc, leu, mg, mn, pro, zn

Details for d2bn7a2

PDB Entry: 2bn7 (more details), 2.4 Å

PDB Description: mn substituted e. coli aminopeptidase p in complex with product and zn
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2bn7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bn7a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2bn7a2:

Click to download the PDB-style file with coordinates for d2bn7a2.
(The format of our PDB-style files is described here.)

Timeline for d2bn7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bn7a1