SCOPe 2.06: Domain d2bmwa2: 2bmw A:142-303

Lineage for d2bmwa2 (2bmw A:142-303)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein automated matches [226995] (7 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1168] [254932] (3 PDB entries)

8. Domain d2bmwa2: 2bmw A:142-303 [128816]
   Other proteins in same PDB: d2bmwa1
   automated match to d1ewya2
   complexed with fad, so4; mutant

Details for d2bmwa2

PDB Entry: 2bmw, 1.5 Å

PDB Description: ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d2bmwa2:

Sequence; same for both SEQRES and ATOM records:

>d2bmwa2 c.25.1.1 (A:142-303) automated matches {Anabaena sp. [TaxId: 1168]}
lpddpeanvimlaggtgitpmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
gpppmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

Timeline for d2bmwa2:

• d2bmwa2 first appeared in SCOP 1.73
  
• d2bmwa2 appears in SCOPe 2.05
  
• d2bmwa2 appears in SCOPe 2.07
  
• d2bmwa2 appears in the current release, SCOPe 2.08