Lineage for d2bmwa2 (2bmw A:142-303)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693238Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 693239Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 693240Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 693251Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 693254Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (24 PDB entries)
  8. 693255Domain d2bmwa2: 2bmw A:142-303 [128816]
    Other proteins in same PDB: d2bmwa1
    automatically matched to d1e62a2
    complexed with fad, so4; mutant

Details for d2bmwa2

PDB Entry: 2bmw (more details), 1.5 Å

PDB Description: ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOP Domain Sequences for d2bmwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
lpddpeanvimlaggtgitpmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
gpppmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d2bmwa2:

Click to download the PDB-style file with coordinates for d2bmwa2.
(The format of our PDB-style files is described here.)

Timeline for d2bmwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmwa1