![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Listeria innocua [TaxId:1642] [186977] (3 PDB entries) |
![]() | Domain d2bjyi_: 2bjy I: [128642] Other proteins in same PDB: d2bjya1 automated match to d1qgha_ mutant |
PDB Entry: 2bjy (more details), 2.6 Å
SCOPe Domain Sequences for d2bjyi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjyi_ a.25.1.1 (I:) automated matches {Listeria innocua [TaxId: 1642]} vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd vtndmliafkasidkhiwmfkaflgkaple
Timeline for d2bjyi_: