Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species) |
Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries) |
Domain d2bjua1: 2bju A:1-329 [128633] automatically matched to d1lf3a_ complexed with ih4 |
PDB Entry: 2bju (more details), 1.56 Å
SCOPe Domain Sequences for d2bjua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi lgdpfmrkyftvfdydnhsvgialakknl
Timeline for d2bjua1: