Lineage for d2bjua1 (2bju A:1-329)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672681Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 672682Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (16 PDB entries)
  8. 672683Domain d2bjua1: 2bju A:1-329 [128633]
    automatically matched to d1lf3a_
    complexed with ih4

Details for d2bjua1

PDB Entry: 2bju (more details), 1.56 Å

PDB Description: plasmepsin ii complexed with a highly active achiral inhibitor
PDB Compounds: (A:) plasmepsin II

SCOP Domain Sequences for d2bjua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d2bjua1:

Click to download the PDB-style file with coordinates for d2bjua1.
(The format of our PDB-style files is described here.)

Timeline for d2bjua1: