Class b: All beta proteins [48724] (178 folds) |
Fold b.169: MFPT repeat-like [141738] (1 superfamily) consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain (63764) |
Superfamily b.169.1: MFPT repeat-like [141739] (1 family) |
Family b.169.1.1: MFPT repeat [141740] (1 protein) PfamB PB008194 |
Protein Sperm motility protein MFP2 [141741] (2 species) |
Species Pig roundworm (Ascaris suum), isoform A [TaxId:6253] [141743] (1 PDB entry) Uniprot Q7YXK2 175-344! Uniprot Q7YXK2 5-174 MFPTa |
Domain d2bjqa2: 2bjq A:5-174 [128627] |
PDB Entry: 2bjq (more details), 1.75 Å
SCOPe Domain Sequences for d2bjqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjqa2 b.169.1.1 (A:5-174) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform A [TaxId: 6253]} efedtwayntigspfpdnpvrvkgqqnmyvalwykfgkpihgrawndngnvecsfpynkv eltgardlggqiqiltateqdpteqfkktgfwyewrpykdrvndqllqlvrcgqstpvim ktkdgkdllgyidmstevaavgvsgkseqvaggpiqdmlvlfrnvkappk
Timeline for d2bjqa2: