Lineage for d2bjqa2 (2bjq A:5-174)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412975Fold b.169: MFPT repeat-like [141738] (1 superfamily)
    consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain (63764)
  4. 2412976Superfamily b.169.1: MFPT repeat-like [141739] (1 family) (S)
  5. 2412977Family b.169.1.1: MFPT repeat [141740] (1 protein)
    PfamB PB008194
  6. 2412978Protein Sperm motility protein MFP2 [141741] (2 species)
  7. 2412979Species Pig roundworm (Ascaris suum), isoform A [TaxId:6253] [141743] (1 PDB entry)
    Uniprot Q7YXK2 175-344! Uniprot Q7YXK2 5-174
    MFPTa
  8. 2412981Domain d2bjqa2: 2bjq A:5-174 [128627]

Details for d2bjqa2

PDB Entry: 2bjq (more details), 1.75 Å

PDB Description: crystal structure of the nematode sperm cell motility protein mfp2
PDB Compounds: (A:) mfp2a

SCOPe Domain Sequences for d2bjqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjqa2 b.169.1.1 (A:5-174) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform A [TaxId: 6253]}
efedtwayntigspfpdnpvrvkgqqnmyvalwykfgkpihgrawndngnvecsfpynkv
eltgardlggqiqiltateqdpteqfkktgfwyewrpykdrvndqllqlvrcgqstpvim
ktkdgkdllgyidmstevaavgvsgkseqvaggpiqdmlvlfrnvkappk

SCOPe Domain Coordinates for d2bjqa2:

Click to download the PDB-style file with coordinates for d2bjqa2.
(The format of our PDB-style files is described here.)

Timeline for d2bjqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjqa1