Lineage for d2bjca1 (2bjc A:1-62)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1995962Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1995978Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1995979Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 1995999Domain d2bjca1: 2bjc A:1-62 [128620]
    protein/DNA complex; mutant

Details for d2bjca1

PDB Entry: 2bjc (more details)

PDB Description: nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor
PDB Compounds: (A:) lactose operon repressor

SCOPe Domain Sequences for d2bjca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjca1 a.35.1.5 (A:1-62) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsvatvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

SCOPe Domain Coordinates for d2bjca1:

Click to download the PDB-style file with coordinates for d2bjca1.
(The format of our PDB-style files is described here.)

Timeline for d2bjca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bjcb_