SCOPe 2.06: Domain d2bjcb_: 2bjc B:

Lineage for d2bjcb_ (2bjc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)

8. Domain d2bjcb_: 2bjc B: [128621]
   automated match to d2bjca1
   protein/DNA complex; mutant

Details for d2bjcb_

PDB Entry: 2bjc

PDB Description: nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor

PDB Compounds: (B:) lactose operon repressor

SCOPe Domain Sequences for d2bjcb_:

Sequence; same for both SEQRES and ATOM records:

>d2bjcb_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsvatvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

Timeline for d2bjcb_:

• d2bjcb_ first appeared in SCOP 1.73, called d2bjcb1
  
• d2bjcb_ appears in SCOPe 2.05
  
• d2bjcb_ appears in SCOPe 2.07
  
• d2bjcb_ appears in the current release, SCOPe 2.08