Class a: All alpha proteins [46456] (284 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.3: CopG-like [100970] (4 proteins) similar to the phage repressor family |
Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species) |
Species Pyrococcus horikoshii [TaxId:53953] [140543] (5 PDB entries) Uniprot O58316 1-50 |
Domain d2bj1a1: 2bj1 A:1-50 [128596] Other proteins in same PDB: d2bj1a2, d2bj1b2 complexed with cl, ni |
PDB Entry: 2bj1 (more details), 3 Å
SCOPe Domain Sequences for d2bj1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj1a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg
Timeline for d2bj1a1: