Lineage for d2biva1 (2biv A:32-138)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055135Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2055321Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2055322Protein automated matches [191144] (3 species)
    not a true protein
  7. 2055332Species Human (Homo sapiens) [TaxId:9606] [189286] (21 PDB entries)
  8. 2055343Domain d2biva1: 2biv A:32-138 [128592]
    automated match to d1oz3a1
    complexed with iod, na

Details for d2biva1

PDB Entry: 2biv (more details), 1.7 Å

PDB Description: crystal structure of the wild-type mbt domains of human scml2
PDB Compounds: (A:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2biva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2biva1 b.34.9.0 (A:32-138) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitga
rlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqmnt

SCOPe Domain Coordinates for d2biva1:

Click to download the PDB-style file with coordinates for d2biva1.
(The format of our PDB-style files is described here.)

Timeline for d2biva1: