SCOPe 2.08: Domain d2biva1: 2biv A:32-138

Lineage for d2biva1 (2biv A:32-138)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)

8. Domain d2biva1: 2biv A:32-138 [128592]
   automated match to d1oz3a1
   complexed with iod, na

Details for d2biva1

PDB Entry: 2biv, 1.7 Å

PDB Description: crystal structure of the wild-type mbt domains of human scml2

PDB Compounds: (A:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2biva1:

Sequence; same for both SEQRES and ATOM records:

>d2biva1 b.34.9.0 (A:32-138) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitga
rlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqmnt

Timeline for d2biva1:

• d2biva1 first appeared in SCOP 1.73
  
• d2biva1 appears in SCOPe 2.07