![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.5: Hef domain-like [140629] (4 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
![]() | Protein DNA repair endonuclease XPF [140634] (2 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [140635] (2 PDB entries) Uniprot Q9YC15 160-229 |
![]() | Domain d2bgwa1: 2bgw A:160-229 [128500] Other proteins in same PDB: d2bgwa2, d2bgwb2 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 2bgw (more details), 2.8 Å
SCOPe Domain Sequences for d2bgwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} kprlsdvrewqlyilqsfpgigrrtaerilerfgslerfftaskaeiskvegigekraee ikkilmtpyk
Timeline for d2bgwa1: