Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
Protein Adenosine deaminase (ADA) [51558] (4 species) Common fold covers the whole protein structure |
Species Cow (Bos taurus) [TaxId:9913] [82257] (13 PDB entries) Uniprot P56658 3-350 ! Uniprot P56658 |
Domain d2bgng1: 2bgn G:4-355 [128494] Other proteins in same PDB: d2bgna1, d2bgna2, d2bgnb1, d2bgnb2, d2bgnc1, d2bgnc2, d2bgnd1, d2bgnd2 automatically matched to d1w1ie_ complexed with nag, zn |
PDB Entry: 2bgn (more details), 3.15 Å
SCOPe Domain Sequences for d2bgng1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgng1 c.1.9.1 (G:4-355) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]} tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps
Timeline for d2bgng1: