Lineage for d2bgng1 (2bgn G:4-355)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. Protein Adenosine deaminase (ADA) [51558] (4 species)
    Common fold covers the whole protein structure
  7. Species Cow (Bos taurus) [TaxId:9913] [82257] (13 PDB entries)
    Uniprot P56658 3-350 ! Uniprot P56658
  8. Domain d2bgng1: 2bgn G:4-355 [128494]
    Other proteins in same PDB: d2bgna1, d2bgna2, d2bgnb1, d2bgnb2, d2bgnc1, d2bgnc2, d2bgnd1, d2bgnd2
    automatically matched to d1w1ie_
    complexed with nag, zn

Details for d2bgng1

PDB Entry: 2bgn (more details), 3.15 Å

PDB Description: hiv-1 tat protein derived n-terminal nonapeptide trp2-tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)
PDB Compounds: (G:) adenosine deaminase

SCOPe Domain Sequences for d2bgng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgng1 c.1.9.1 (G:4-355) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps

SCOPe Domain Coordinates for d2bgng1 are not available.

Timeline for d2bgng1:

Domains from other chains:
(mouse over for more information)
d2bgna1, d2bgna2, d2bgnb1, d2bgnb2, d2bgnc1, d2bgnc2, d2bgnd1, d2bgnd2, d2bgne1, d2bgnf1, d2bgnh1