SCOPe 2.01: Domain d2bfus1: 2bfu S:1-189

Lineage for d2bfus1 (2bfu S:1-189)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (2 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
   chain 1 is one-domain VP23; chain 2 is two-domain VP37

7. Species CPMV (Cowpea mosaic virus) [TaxId:12264] [89227] (2 PDB entries)

8. Domain d2bfus1: 2bfu S:1-189 [128455]
   automatically matched to d1ny711

Details for d2bfus1

PDB Entry: 2bfu, 4 Å

PDB Description: x-ray structure of cpmv top component

PDB Compounds: (S:) cowpea mosaic virus, small (s) subunit

SCOPe Domain Sequences for d2bfus1:

Sequence; same for both SEQRES and ATOM records:

>d2bfus1 b.121.4.2 (S:1-189) Comovirus coat proteins (VP37 and VP23) {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
gpvcaeasdvyspcmiastppapfsdvtavtfdlingkitpvgddnwnthiynppimnvl
rtaawksgtihvqlnvrgagvkradwdgqvfvylrqsmnpesydartfvisqpgsamlnf
sfdiigpnsgfefaespwanqttwylecvatnprqiqqfevnmrfdpnfrvagnilmppf
plstetppl

Timeline for d2bfus1:

• d2bfus1 first appeared in SCOP 1.73
  
• d2bfus1 appears in SCOP 1.75
  
• d2bfus1 appears in SCOPe 2.02
  
• d2bfus1 appears in the current release, SCOPe 2.08