Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Beta-D-xylosidase, catalytic domain [102077] (2 species) glycosyl hydrolase family 39 |
Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries) Uniprot Q9ZFM2 15-361 |
Domain d2bfgd2: 2bfg D:14-360 [128430] Other proteins in same PDB: d2bfga1, d2bfgb1, d2bfgc1, d2bfgd1, d2bfge1, d2bfgf1, d2bfgg1, d2bfgh1 automated match to d2bfga2 complexed with anx, na, so4, xys |
PDB Entry: 2bfg (more details), 2.4 Å
SCOPe Domain Sequences for d2bfgd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfgd2 c.1.8.3 (D:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl ivavvshfierygieevrtwlfevwnapnlvnfwkdankqeyfklyevtaravksvdphl qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
Timeline for d2bfgd2: