SCOP 1.73: Domain d2bfgd2: 2bfg D:14-360

Lineage for d2bfgd2 (2bfg D:14-360)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (24 proteins)
   consist of a number of sequence families

6. Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
   glycosyl hydrolase family 39

7. Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries)

8. Domain d2bfgd2: 2bfg D:14-360 [128430]
   Other proteins in same PDB: d2bfga1, d2bfgb1, d2bfgc1, d2bfgd1, d2bfge1, d2bfgf1, d2bfgg1, d2bfgh1
   automatically matched to 2BFG A:14-360
   complexed with anx, na, so4, xyp, xys; mutant

Details for d2bfgd2

PDB Entry: 2bfg, 2.4 Å

PDB Description: crystal structure of beta-xylosidase (fam gh39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside

PDB Compounds: (D:) beta-xylosidase

SCOP Domain Sequences for d2bfgd2:

Sequence; same for both SEQRES and ATOM records:

>d2bfgd2 c.1.8.3 (D:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem
kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl
ivavvshfierygieevrtwlfevwnapnlvnfwkdankqeyfklyevtaravksvdphl
qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm
leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf
sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd

Timeline for d2bfgd2:

• d2bfgd2 is new in SCOP 1.73
  
• d2bfgd2 appears in SCOP 1.75
  
• d2bfgd2 appears in the current release, SCOPe 2.08