SCOPe 2.08: Domain d2bf8a_: 2bf8 A:

Lineage for d2bf8a_ (2bf8 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186972] (1 PDB entry)

8. Domain d2bf8a_: 2bf8 A: [128411]
   Other proteins in same PDB: d2bf8b_
   automated match to d1fxta_

Details for d2bf8a_

PDB Entry: 2bf8, 2.3 Å

PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2bf8a_:

Sequence; same for both SEQRES and ATOM records:

>d2bf8a_ d.20.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleik
ipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaae
pddpqdavvanqykqnpemfkqtarlwahvyaga

Timeline for d2bf8a_:

• d2bf8a_ first appeared in SCOP 1.73, called d2bf8a1
  
• d2bf8a_ appears in SCOPe 2.07