![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
![]() | Protein automated matches [190120] (9 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186972] (1 PDB entry) |
![]() | Domain d2bf8a_: 2bf8 A: [128411] Other proteins in same PDB: d2bf8b_ automated match to d1fxta_ |
PDB Entry: 2bf8 (more details), 2.3 Å
SCOPe Domain Sequences for d2bf8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bf8a_ d.20.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} aniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleik ipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaae pddpqdavvanqykqnpemfkqtarlwahvyaga
Timeline for d2bf8a_: