Lineage for d2bf8b_ (2bf8 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933251Domain d2bf8b_: 2bf8 B: [128412]
    Other proteins in same PDB: d2bf8a_
    automated match to d2ckhb1

Details for d2bf8b_

PDB Entry: 2bf8 (more details), 2.3 Å

PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k
PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d2bf8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bf8b_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

SCOPe Domain Coordinates for d2bf8b_:

Click to download the PDB-style file with coordinates for d2bf8b_.
(The format of our PDB-style files is described here.)

Timeline for d2bf8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bf8a_