Lineage for d2bera3 (2ber A:47-402)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807958Protein automated matches [193245] (21 species)
    not a true protein
  7. 2808067Species Micromonospora viridifaciens [TaxId:1881] [254941] (4 PDB entries)
  8. 2808068Domain d2bera3: 2ber A:47-402 [128388]
    Other proteins in same PDB: d2bera1, d2bera2
    automated match to d1euta3
    complexed with na, slb; mutant

Details for d2bera3

PDB Entry: 2ber (more details), 1.8 Å

PDB Description: y370g active site mutant of the sialidase from micromonospora viridifaciens in complex with beta-neu5ac (sialic acid).
PDB Compounds: (A:) bacterial sialidase

SCOPe Domain Sequences for d2bera3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bera3 b.68.1.1 (A:47-402) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsgstltalpdgtygllyepgtgiryanfnlawlg

SCOPe Domain Coordinates for d2bera3:

Click to download the PDB-style file with coordinates for d2bera3.
(The format of our PDB-style files is described here.)

Timeline for d2bera3: