Lineage for d2be5m_ (2be5 M:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249907Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 2249961Protein automated matches [190192] (4 species)
    not a true protein
  7. 2249979Species Thermus thermophilus [TaxId:274] [186932] (8 PDB entries)
  8. 2249983Domain d2be5m_: 2be5 M: [128365]
    Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5n_, d2be5o_, d2be5p1, d2be5p2, d2be5p3
    automated match to d1iw7c_
    protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5m_

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (M:) DNA-directed RNA polymerase beta chain

SCOPe Domain Sequences for d2be5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5m_ e.29.1.1 (M:) automated matches {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d2be5m_:

Click to download the PDB-style file with coordinates for d2be5m_.
(The format of our PDB-style files is described here.)

Timeline for d2be5m_: