SCOPe 2.08: Domain d2be3b_: 2be3 B:

Lineage for d2be3b_ (2be3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins)
   Pfam PF04607; ppGpp-synthetase

6. Protein Putative GTP pyrophosphokinase SP1097 [143234] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143235] (1 PDB entry)
   Uniprot Q97QV1 1-203

8. Domain d2be3b_: 2be3 B: [128350]
   automated match to d2be3a1
   complexed with cl, gol, pg4
   has additional insertions and/or extensions that are not grouped together

Details for d2be3b_

PDB Entry: 2be3, 2.4 Å

PDB Description: structure of a gtp pyrophosphokinase family protein from streptococcus pneumoniae

PDB Compounds: (B:) GTP pyrophosphokinase

SCOPe Domain Sequences for d2be3b_:

Sequence, based on SEQRES records:

>d2be3b_ d.218.1.8 (B:) Putative GTP pyrophosphokinase SP1097 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmarrgi
tyatlehdlqdiaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhv
vveytvdtingaktilaeiqirtlamnfwatiehslnykyqgdfpdeikkrleitariah
qldeemgeirddiqeaqalf

Sequence, based on observed residues (ATOM records):

>d2be3b_ d.218.1.8 (B:) Putative GTP pyrophosphokinase SP1097 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmahdlq
diaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhvvveytvdtin
gaktilaeiqirtlamnfwatiehslnykyqdfpdeikkrleitariahqldeemgeird
diqeaqalf

Timeline for d2be3b_:

• d2be3b_ first appeared in SCOP 1.73, called d2be3b1
  
• d2be3b_ appears in SCOPe 2.07