Lineage for d2be3b1 (2be3 B:2-201)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740317Family d.218.1.8: RelA/SpoT domain [102945] (2 proteins)
    Pfam PF04607; ppGpp-synthetase
  6. 740318Protein Putative GTP pyrophosphokinase SP1097 [143234] (1 species)
  7. 740319Species Streptococcus pneumoniae [TaxId:1313] [143235] (1 PDB entry)
  8. 740321Domain d2be3b1: 2be3 B:2-201 [128350]
    automatically matched to 2BE3 A:1-203
    complexed with cl, gol, pg4

Details for d2be3b1

PDB Entry: 2be3 (more details), 2.4 Å

PDB Description: structure of a gtp pyrophosphokinase family protein from streptococcus pneumoniae
PDB Compounds: (B:) GTP pyrophosphokinase

SCOP Domain Sequences for d2be3b1:

Sequence, based on SEQRES records: (download)

>d2be3b1 d.218.1.8 (B:2-201) Putative GTP pyrophosphokinase SP1097 {Streptococcus pneumoniae [TaxId: 1313]}
tleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmarrgi
tyatlehdlqdiaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhv
vveytvdtingaktilaeiqirtlamnfwatiehslnykyqgdfpdeikkrleitariah
qldeemgeirddiqeaqalf

Sequence, based on observed residues (ATOM records): (download)

>d2be3b1 d.218.1.8 (B:2-201) Putative GTP pyrophosphokinase SP1097 {Streptococcus pneumoniae [TaxId: 1313]}
tleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmahdlq
diaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhvvveytvdtin
gaktilaeiqirtlamnfwatiehslnykyqdfpdeikkrleitariahqldeemgeird
diqeaqalf

SCOP Domain Coordinates for d2be3b1:

Click to download the PDB-style file with coordinates for d2be3b1.
(The format of our PDB-style files is described here.)

Timeline for d2be3b1: