Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin K [54028] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54029] (40 PDB entries) Uniprot P43235 116-329 ! Uniprot P43235 115-329 |
Domain d2bdla_: 2bdl A: [128339] automated match to d2r6na1 complexed with 4pr |
PDB Entry: 2bdl (more details), 2 Å
SCOPe Domain Sequences for d2bdla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdla_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii knswgenwgnkgyilmarnknnacgianlasfpkm
Timeline for d2bdla_: