PDB entry 2bdl

View 2bdl on RCSB PDB site
Description: Cathepsin K complexed with a pyrrolidine ketoamide-based inhibitor
Class: hydrolase
Keywords: cathepsin, cysteine protease, catK, catO, HYDROLASE
Deposited on 2005-10-20, released 2006-03-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bdla_
  • Heterogens: 4PR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bdlA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm