SCOPe 2.08: Domain d2bdla_: 2bdl A:

Lineage for d2bdla_ (2bdl A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d2bdla_: 2bdl A: [128339]
   automated match to d2r6na1
   complexed with 4pr

Details for d2bdla_

PDB Entry: 2bdl, 2 Å

PDB Description: cathepsin k complexed with a pyrrolidine ketoamide-based inhibitor

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d2bdla_:

Sequence; same for both SEQRES and ATOM records:

>d2bdla_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d2bdla_:

• d2bdla_ first appeared in SCOP 1.73, called d2bdla1
  
• d2bdla_ appears in SCOPe 2.07