SCOPe 2.02: Domain d2bayf_: 2bay F:

Lineage for d2bayf_ (2bay F:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein automated matches [190212] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry)

8. Domain d2bayf_: 2bay F: [128256]
   automated match to d1n87a_

Details for d2bayf_

PDB Entry: 2bay, 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer

PDB Compounds: (F:) Pre-mRNA splicing factor PRP19

SCOPe Domain Sequences for d2bayf_:

Sequence; same for both SEQRES and ATOM records:

>d2bayf_ g.44.1.2 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivpsa

Timeline for d2bayf_:

• d2bayf_ first appeared in SCOP 1.73, called d2bayf1
  
• d2bayf_ appears in SCOPe 2.01
  
• d2bayf_ appears in SCOPe 2.03
  
• d2bayf_ appears in the current release, SCOPe 2.08, called d2bayf2