Lineage for d2baya_ (2bay A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245811Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1245812Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1245863Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 1245880Protein automated matches [190212] (1 species)
    not a true protein
  7. 1245881Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry)
  8. 1245882Domain d2baya_: 2bay A: [128251]
    automated match to d1n87a_

Details for d2baya_

PDB Entry: 2bay (more details), 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer
PDB Compounds: (A:) Pre-mRNA splicing factor PRP19

SCOPe Domain Sequences for d2baya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2baya_ g.44.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps

SCOPe Domain Coordinates for d2baya_:

Click to download the PDB-style file with coordinates for d2baya_.
(The format of our PDB-style files is described here.)

Timeline for d2baya_: