Lineage for d2basa1 (2bas A:2-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840940Superfamily c.1.33: EAL domain-like [141868] (1 family) (S)
    variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest
    automatically mapped to Pfam PF00563
  5. 2840941Family c.1.33.1: EAL domain [141869] (1 protein)
    Pfam PF00563
  6. 2840942Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species)
  7. 2840943Species Bacillus subtilis [TaxId:1423] [141871] (2 PDB entries)
    Uniprot O35014 2-262
  8. 2840944Domain d2basa1: 2bas A:2-262 [128244]
    Other proteins in same PDB: d2basa2, d2basb2, d2basb3
    complexed with bme

Details for d2basa1

PDB Entry: 2bas (more details), 2.61 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain.
PDB Compounds: (A:) YkuI protein

SCOPe Domain Sequences for d2basa1:

Sequence, based on SEQRES records: (download)

>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalkv
sqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetfl
erdvlkqrlktefhqfithek

Sequence, based on observed residues (ATOM records): (download)

>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalks
psyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerdv
lkqrlktefhqfithek

SCOPe Domain Coordinates for d2basa1:

Click to download the PDB-style file with coordinates for d2basa1.
(The format of our PDB-style files is described here.)

Timeline for d2basa1: