Lineage for d2basb1 (2bas B:1-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840940Superfamily c.1.33: EAL domain-like [141868] (1 family) (S)
    variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest
    automatically mapped to Pfam PF00563
  5. 2840941Family c.1.33.1: EAL domain [141869] (1 protein)
    Pfam PF00563
  6. 2840942Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species)
  7. 2840943Species Bacillus subtilis [TaxId:1423] [141871] (2 PDB entries)
    Uniprot O35014 2-262
  8. 2840945Domain d2basb1: 2bas B:1-262 [128246]
    Other proteins in same PDB: d2basa2, d2basb2, d2basb3
    automated match to d2basa1
    complexed with bme

Details for d2basb1

PDB Entry: 2bas (more details), 2.61 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain.
PDB Compounds: (B:) YkuI protein

SCOPe Domain Sequences for d2basb1:

Sequence, based on SEQRES records: (download)

>d2basb1 c.1.33.1 (B:1-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey
klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv
leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk
vsqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetf
lerdvlkqrlktefhqfithek

Sequence, based on observed residues (ATOM records): (download)

>d2basb1 c.1.33.1 (B:1-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey
klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv
leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk
spsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerd
vlkqrlktefhqfithek

SCOPe Domain Coordinates for d2basb1:

Click to download the PDB-style file with coordinates for d2basb1.
(The format of our PDB-style files is described here.)

Timeline for d2basb1: