PDB entry 2bas

View 2bas on RCSB PDB site
Description: Crystal Structure of the Bacillus subtilis YkuI Protein, with an EAL Domain.
Class: signaling protein
Keywords: YkuI protein, EAL domain, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, SIGNALING PROTEIN
Deposited on 2005-10-14, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YkuI protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykuI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2basa1, d2basa2
  • Chain 'B':
    Compound: YkuI protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykuI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35014 (24-End)
      • cloning artifact (23)
    Domains in SCOPe 2.08: d2basb1, d2basb2, d2basb3
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2basA (A:)
    mhhhhhhssgvdlgtenlyfqsnamldpldiltniddvlpyyqaifsaeeqkvvgyevlg
    riladseiqslgpffldagipeeyklevdnriirqaldrfleadsdllifmnqdanllml
    dhgesflellkeyeakgielhrfvleitehnfegdieqlyhmlayyrtygikiavdnigk
    essnldriallspdllkidlqalkvsqpspsyehvlysisllarkigaallyedieanfq
    lqyawrnggryfqgyylvspsetflerdvlkqrlktefhqfithekkkletvyehseqfy
    krvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdqltgnvfkqdgewiyq
    peyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfsypmddqmylfidlp
    ysylyeqdgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2basA (A:)
    ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
    levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
    eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalks
    psyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerdv
    lkqrlktefhqfithekkkletvyehseqfykrvhqavtslrknnlssdddfikklaeel
    tdcsfriymcdeegdqltgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgff
    sdlysdletgemirtfsypmddqmylfidlpysylyeqdgli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2basB (B:)
    mhhhhhhssgvdlgtenlyfqsnamldpldiltniddvlpyyqaifsaeeqkvvgyevlg
    riladseiqslgpffldagipeeyklevdnriirqaldrfleadsdllifmnqdanllml
    dhgesflellkeyeakgielhrfvleitehnfegdieqlyhmlayyrtygikiavdnigk
    essnldriallspdllkidlqalkvsqpspsyehvlysisllarkigaallyedieanfq
    lqyawrnggryfqgyylvspsetflerdvlkqrlktefhqfithekkkletvyehseqfy
    krvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdqltgnvfkqdgewiyq
    peyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfsypmddqmylfidlp
    ysylyeqdgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2basB (B:)
    amldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipee
    yklevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrf
    vleitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqal
    kspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetfler
    dvlkqrlktefhqfithekkkletvyehseqfykrvhqavtslrknnlssdddfikklae
    eltdcsfriymcdeegdqltgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkg
    ffsdlysdletgemirtfsypmddqmylfidlpysyl