SCOPe 2.01: Domain d2b97b_: 2b97 B:

Lineage for d2b97b_ (2b97 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
   core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection

4. Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family)

5. Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
   a self-assembling amphiphile

6. Protein Hydrophobin II, HfbII [101753] (1 species)

7. Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)

8. Domain d2b97b_: 2b97 B: [128119]
   automated match to d1r2ma_
   complexed with mn

Details for d2b97b_

PDB Entry: 2b97, 0.75 Å

PDB Description: Ultra-high resolution structure of hydrophobin HFBII

PDB Compounds: (B:) Hydrophobin II

SCOPe Domain Sequences for d2b97b_:

Sequence; same for both SEQRES and ATOM records:

>d2b97b_ b.138.1.1 (B:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigt

Timeline for d2b97b_:

• d2b97b_ first appeared in SCOP 1.73, called d2b97b1
  
• d2b97b_ was called d2b97b1 in SCOP 1.75
  
• d2b97b_ appears in SCOPe 2.02
  
• d2b97b_ appears in the current release, SCOPe 2.08