Lineage for d1r2ma_ (1r2m A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967483Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 967484Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) (S)
  5. 967485Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
    a self-assembling amphiphile
  6. 967486Protein Hydrophobin II, HfbII [101753] (1 species)
  7. 967487Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)
  8. 967490Domain d1r2ma_: 1r2m A: [96871]
    complexed with mn

Details for d1r2ma_

PDB Entry: 1r2m (more details), 1 Å

PDB Description: Atomic resolution structure of the HFBII hydrophobin: a self-assembling amphiphile
PDB Compounds: (A:) Hydrophobin II

SCOPe Domain Sequences for d1r2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ma_ b.138.1.1 (A:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigt

SCOPe Domain Coordinates for d1r2ma_:

Click to download the PDB-style file with coordinates for d1r2ma_.
(The format of our PDB-style files is described here.)

Timeline for d1r2ma_:

967490
d1r2ma_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1r2mb_