SCOP 1.73: Domain d2b8pa1: 2b8p A:2-129

Lineage for d2b8pa1 (2b8p A:2-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)

8. Domain d2b8pa1: 2b8p A:2-129 [128101]
   complexed with so4

Details for d2b8pa1

PDB Entry: 2b8p, 2.55 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus NDK, the first viral nucleoside diphosphate kinase

PDB Compounds: (A:) Probable nucleoside diphosphate kinase

SCOP Domain Sequences for d2b8pa1:

Sequence, based on SEQRES records:

>d2b8pa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

Sequence, based on observed residues (ATOM records):

>d2b8pa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykeyfndncdfm
vsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsavdeisi
wfp

Timeline for d2b8pa1:

• d2b8pa1 is new in SCOP 1.73
  
• d2b8pa1 appears in SCOP 1.75
  
• d2b8pa1 appears in the current release, SCOPe 2.08