Lineage for d2b8pb1 (2b8p B:2-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724223Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)
  8. 724231Domain d2b8pb1: 2b8p B:2-129 [128102]
    automatically matched to 2B8P A:2-129
    complexed with so4

Details for d2b8pb1

PDB Entry: 2b8p (more details), 2.55 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus NDK, the first viral nucleoside diphosphate kinase
PDB Compounds: (B:) Probable nucleoside diphosphate kinase

SCOP Domain Sequences for d2b8pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8pb1 d.58.6.1 (B:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

SCOP Domain Coordinates for d2b8pb1:

Click to download the PDB-style file with coordinates for d2b8pb1.
(The format of our PDB-style files is described here.)

Timeline for d2b8pb1: