Lineage for d2b8kc1 (2b8k C:3-37,C:173-268)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524493Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524624Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2524625Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2524703Protein RPB3 [64315] (2 species)
  7. 2524704Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2524729Domain d2b8kc1: 2b8k C:3-37,C:173-268 [128078]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1i3qc1
    complexed with zn

Details for d2b8kc1

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2b8kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8kc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2b8kc1:

Click to download the PDB-style file with coordinates for d2b8kc1.
(The format of our PDB-style files is described here.)

Timeline for d2b8kc1: