Lineage for d2b8ke2 (2b8k E:144-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958567Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2958568Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2958569Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2958570Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2958571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2958600Domain d2b8ke2: 2b8k E:144-215 [128082]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1dzfa2
    complexed with zn

Details for d2b8ke2

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2b8ke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8ke2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2b8ke2:

Click to download the PDB-style file with coordinates for d2b8ke2.
(The format of our PDB-style files is described here.)

Timeline for d2b8ke2: