Lineage for d2b8kf1 (2b8k F:72-155)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734803Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2734804Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2734837Domain d2b8kf1: 2b8k F:72-155 [128083]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke1, d2b8ke2, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1i3qf_
    complexed with zn

Details for d2b8kf1

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2b8kf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8kf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2b8kf1:

Click to download the PDB-style file with coordinates for d2b8kf1.
(The format of our PDB-style files is described here.)

Timeline for d2b8kf1: