Lineage for d2b7kb_ (2b7k B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485757Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 2485762Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries)
    Uniprot P23833 111-262
  8. 2485764Domain d2b7kb_: 2b7k B: [128043]
    automated match to d2b7ja1
    complexed with pt

Details for d2b7kb_

PDB Entry: 2b7k (more details), 1.8 Å

PDB Description: Crystal Structure of Yeast Sco1
PDB Compounds: (B:) SCO1 protein

SCOPe Domain Sequences for d2b7kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7kb_ c.47.1.10 (B:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlsskygi
tlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvkpg
qdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksy

SCOPe Domain Coordinates for d2b7kb_:

Click to download the PDB-style file with coordinates for d2b7kb_.
(The format of our PDB-style files is described here.)

Timeline for d2b7kb_: