![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142372] (2 PDB entries) Uniprot P23833 111-262 |
![]() | Domain d2b7ka_: 2b7k A: [128042] automated match to d2b7ja1 complexed with pt |
PDB Entry: 2b7k (more details), 1.8 Å
SCOPe Domain Sequences for d2b7ka_:
Sequence, based on SEQRES records: (download)
>d2b7ka_ c.47.1.10 (A:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvyfstppnvk pgqdylvdhsiffylmdpegqfvdalgrnydektgvdkivehvksyvpa
>d2b7ka_ c.47.1.10 (A:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gkpslggpfhledmygnefteknllgkfsiiyfgfsncpdicpdeldklglwlntlssky gitlqplfitcdpardspavlkeylsdfhpsilgltgtfdevknackkyrvlvdhsiffy lmdpegqfvdalgrnydektgvdkivehvksyvpa
Timeline for d2b7ka_: