SCOPe 2.01: Domain d2b59b2: 2b59 B:8-103

Lineage for d2b59b2 (2b59 B:8-103)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (2 families)

5. Family b.3.2.2: Pre-dockerin domain [141082] (1 protein)
   PfamB PB085396

6. Protein Cellulosomal scaffolding protein A [141083] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [141084] (1 PDB entry)
   Uniprot Q06851 1697-1792

8. Domain d2b59b2: 2b59 B:8-103 [127881]
   Other proteins in same PDB: d2b59a1, d2b59b1
   complexed with ca

Details for d2b59b2

PDB Entry: 2b59, 2.11 Å

PDB Description: the type ii cohesin dockerin complex

PDB Compounds: (B:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d2b59b2:

Sequence; same for both SEQRES and ATOM records:

>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]}
gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
isratyldrvianvvvtgdtsvstsqapimmwvgdi

Timeline for d2b59b2:

• d2b59b2 first appeared in SCOP 1.73
  
• d2b59b2 appears in SCOP 1.75
  
• d2b59b2 appears in SCOPe 2.02
  
• d2b59b2 appears in the current release, SCOPe 2.08