Lineage for d2b59b2 (2b59 B:8-103)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790504Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (2 families) (S)
  5. 790513Family b.3.2.2: Pre-dockerin domain [141082] (1 protein)
    PfamB PB085396
  6. 790514Protein Cellulosomal scaffolding protein A [141083] (1 species)
  7. 790515Species Clostridium thermocellum [TaxId:1515] [141084] (1 PDB entry)
    Uniprot Q06851 1697-1792
  8. 790516Domain d2b59b2: 2b59 B:8-103 [127881]
    Other proteins in same PDB: d2b59a1, d2b59b1
    complexed with ca

Details for d2b59b2

PDB Entry: 2b59 (more details), 2.11 Å

PDB Description: the type ii cohesin dockerin complex
PDB Compounds: (B:) cellulosomal scaffolding protein a

SCOP Domain Sequences for d2b59b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]}
gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
isratyldrvianvvvtgdtsvstsqapimmwvgdi

SCOP Domain Coordinates for d2b59b2:

Click to download the PDB-style file with coordinates for d2b59b2.
(The format of our PDB-style files is described here.)

Timeline for d2b59b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b59b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2b59a1