SCOPe 2.08: Domain d2ayva1: 2ayv A:2-146

Lineage for d2ayva1 (2ayv A:2-146)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Toxoplasma gondii [TaxId:5811] [143059] (1 PDB entry)

8. Domain d2ayva1: 2ayv A:2-146 [127572]
   Other proteins in same PDB: d2ayva2
   complexed with unx

Details for d2ayva1

PDB Entry: 2ayv, 2 Å

PDB Description: crystal structure of a putative ubiquitin-conjugating enzyme e2 from toxoplasma gondii

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2

SCOPe Domain Sequences for d2ayva1:

Sequence; same for both SEQRES and ATOM records:

>d2ayva1 d.20.1.1 (A:2-146) Ubiquitin conjugating enzyme, UBC {Toxoplasma gondii [TaxId: 5811]}
alkrinkelndlskdpptncsagpvgddmfhwqatimgpedspysggvfflnihfpsdyp
fkppkvnfttkiyhpninsqgaicldilkdqwspaltiskvllsisslltdpnpddplvp
eiahlyksdrmrydqtarewsqkya

Timeline for d2ayva1:

• d2ayva1 first appeared in SCOP 1.73
  
• d2ayva1 appears in SCOPe 2.07