Lineage for d2axzb2 (2axz B:70-287)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279354Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1279476Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)
  6. 1279477Protein PrgX [140849] (1 species)
  7. 1279478Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 1279510Domain d2axzb2: 2axz B:70-287 [127539]
    Other proteins in same PDB: d2axza1, d2axzb1, d2axzc1, d2axzd1
    automatically matched to 2AW6 A:70-287
    protein/DNA complex

Details for d2axzb2

PDB Entry: 2axz (more details), 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axzb2 a.118.8.4 (B:70-287) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisake

SCOPe Domain Coordinates for d2axzb2:

Click to download the PDB-style file with coordinates for d2axzb2.
(The format of our PDB-style files is described here.)

Timeline for d2axzb2: