Lineage for d2axzb2 (2axz B:67-305)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. Protein automated matches [254479] (1 species)
    not a true protein
  7. Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)
  8. Domain d2axzb2: 2axz B:67-305 [127539]
    Other proteins in same PDB: d2axza1, d2axzb1, d2axzc1, d2axzd1
    automated match to d2awia2
    protein/DNA complex

Details for d2axzb2

PDB Entry: 2axz (more details), 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axzb2 a.118.8.4 (B:67-305) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyvai

SCOPe Domain Coordinates for d2axzb2 are not available.

Timeline for d2axzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2axzb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2axza1, d2axza2, d2axzc1, d2axzc2, d2axzd1, d2axzd2